Lineage for d2fjub1 (2fju B:142-311)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1994319Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1994320Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1995442Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 protein domains)
  6. 1995501Protein Phospholipase C-beta-2 [158478] (1 species)
  7. 1995502Species Human (Homo sapiens) [TaxId:9606] [158479] (2 PDB entries)
    Uniprot Q00722 142-311
  8. 1995504Domain d2fjub1: 2fju B:142-311 [145170]
    Other proteins in same PDB: d2fjua_, d2fjub2, d2fjub3, d2fjub4
    complexed with ca, gsp, mg

Details for d2fjub1

PDB Entry: 2fju (more details), 2.2 Å

PDB Description: Activated Rac1 bound to its effector phospholipase C beta 2
PDB Compounds: (B:) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta 2

SCOPe Domain Sequences for d2fjub1:

Sequence, based on SEQRES records: (download)

>d2fjub1 a.39.1.7 (B:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}
asrstfldkilvklkmqlnsegkipvknffqmfpadrkrveaalsachlpkgkndainpe
dfpepvyksflmslcprpeideiftsyhakakpymtkehltkfinqkqrdsrlnsllfpp
arpdqvqglidkyepsginaqrgqlspegmvwflcgpensvlaqdklllh

Sequence, based on observed residues (ATOM records): (download)

>d2fjub1 a.39.1.7 (B:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}
asrstfldkilvklkmqlnsegkipvknffqmfpadrkrveaalsachlpkgkndainpe
dfpepvyksflmslcprpeideiftsymtkehltkfinqkqrdqglidkyepsgqlspeg
mvwflcgpensvlaqdklllh

SCOPe Domain Coordinates for d2fjub1:

Click to download the PDB-style file with coordinates for d2fjub1.
(The format of our PDB-style files is described here.)

Timeline for d2fjub1: