Lineage for d2fdbn_ (2fdb N:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543030Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1543031Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 1543032Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 1543307Protein automated matches [190637] (2 species)
    not a true protein
  7. 1543308Species Human (Homo sapiens) [TaxId:9606] [187699] (6 PDB entries)
  8. 1543311Domain d2fdbn_: 2fdb N: [145163]
    Other proteins in same PDB: d2fdbm1, d2fdbp1, d2fdbp2, d2fdbr1, d2fdbr2
    automated match to d2fdbm1

Details for d2fdbn_

PDB Entry: 2fdb (more details), 2.28 Å

PDB Description: crystal structure of fibroblast growth factor (fgf)8b in complex with fgf receptor (fgfr) 2c
PDB Compounds: (N:) fibroblast growth factor 8 isoform B

SCOPe Domain Sequences for d2fdbn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fdbn_ b.42.1.1 (N:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ftqhvreqslvtdqlsrrlirtyqlysrtsgkhvqvlankrinamaedgdpfaklivetd
tfgsrvrvrgaetglyicmnkkgkliaksngkgkdcvfteivlennytalqnakyegwym
aftrkgrprkgsktrqhqrevhfmkrlp

SCOPe Domain Coordinates for d2fdbn_:

Click to download the PDB-style file with coordinates for d2fdbn_.
(The format of our PDB-style files is described here.)

Timeline for d2fdbn_: