SCOPe 2.04: Domain d2fdbn_: 2fdb N:

Lineage for d2fdbn_ (2fdb N:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein automated matches [190637] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187699] (6 PDB entries)

8. Domain d2fdbn_: 2fdb N: [145163]
   Other proteins in same PDB: d2fdbm1, d2fdbp1, d2fdbp2, d2fdbr1, d2fdbr2
   automated match to d2fdbm1

Details for d2fdbn_

PDB Entry: 2fdb, 2.28 Å

PDB Description: crystal structure of fibroblast growth factor (fgf)8b in complex with fgf receptor (fgfr) 2c

PDB Compounds: (N:) fibroblast growth factor 8 isoform B

SCOPe Domain Sequences for d2fdbn_:

Sequence; same for both SEQRES and ATOM records:

>d2fdbn_ b.42.1.1 (N:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ftqhvreqslvtdqlsrrlirtyqlysrtsgkhvqvlankrinamaedgdpfaklivetd
tfgsrvrvrgaetglyicmnkkgkliaksngkgkdcvfteivlennytalqnakyegwym
aftrkgrprkgsktrqhqrevhfmkrlp

Timeline for d2fdbn_:

• d2fdbn_ first appeared in SCOP 1.75, called d2fdbn1
  
• d2fdbn_ appears in SCOPe 2.03
  
• d2fdbn_ appears in SCOPe 2.05
  
• d2fdbn_ appears in the current release, SCOPe 2.08