Lineage for d2fdbm1 (2fdb M:34-180)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1790651Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1790652Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 1790653Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 1790923Protein Fibroblast growth factor 8, FGF8 [159145] (1 species)
  7. 1790924Species Human (Homo sapiens) [TaxId:9606] [159146] (1 PDB entry)
    Uniprot P55075 52-198
  8. 1790925Domain d2fdbm1: 2fdb M:34-180 [145162]
    Other proteins in same PDB: d2fdbn_, d2fdbp1, d2fdbp2, d2fdbr1, d2fdbr2

Details for d2fdbm1

PDB Entry: 2fdb (more details), 2.28 Å

PDB Description: crystal structure of fibroblast growth factor (fgf)8b in complex with fgf receptor (fgfr) 2c
PDB Compounds: (M:) fibroblast growth factor 8 isoform B

SCOPe Domain Sequences for d2fdbm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fdbm1 b.42.1.1 (M:34-180) Fibroblast growth factor 8, FGF8 {Human (Homo sapiens) [TaxId: 9606]}
qhvreqslvtdqlsrrlirtyqlysrtsgkhvqvlankrinamaedgdpfaklivetdtf
gsrvrvrgaetglyicmnkkgkliaksngkgkdcvfteivlennytalqnakyegwymaf
trkgrprkgsktrqhqrevhfmkrlpr

SCOPe Domain Coordinates for d2fdbm1:

Click to download the PDB-style file with coordinates for d2fdbm1.
(The format of our PDB-style files is described here.)

Timeline for d2fdbm1: