Lineage for d2fd6u2 (2fd6 U:189-275)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1241631Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 1241632Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 1241837Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (5 proteins)
  6. 1241886Protein Urokinase plasminogen activator surface receptor uPAR [161128] (1 species)
    duplication: tandem repeat of three similar domains; the N-terminal and C-terminal domains belong to Pfam PF00021; uPAR/Ly6
  7. 1241887Species Human (Homo sapiens) [TaxId:9606] [161129] (5 PDB entries)
    Uniprot Q03405 109-209! Uniprot Q03405 210-299! Uniprot Q03405 23-108
  8. 1241889Domain d2fd6u2: 2fd6 U:189-275 [145160]
    Other proteins in same PDB: d2fd6a1, d2fd6a2, d2fd6h1, d2fd6h2, d2fd6l1, d2fd6l2
    complexed with edo, etx, nag, ndg, pg4, pge, so4

Details for d2fd6u2

PDB Entry: 2fd6 (more details), 1.9 Å

PDB Description: Structure of Human Urokinase Plasminogen Activator in Complex with Urokinase Receptor and an anti-upar antibody at 1.9 A
PDB Compounds: (U:) Urokinase plasminogen activator surface receptor

SCOPe Domain Sequences for d2fd6u2:

Sequence, based on SEQRES records: (download)

>d2fd6u2 g.7.1.3 (U:189-275) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]}
qngrqcysckgnsthgcsseetflidcrgpmnqclvatgthepknqsymvrgcatasmcq
hahlgdafsmnhidvscctksgcnhpd

Sequence, based on observed residues (ATOM records): (download)

>d2fd6u2 g.7.1.3 (U:189-275) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]}
qngrqcysckgnsthgcsseetflidcrgpmnqclvatgthepknqsymvrgcatasmcq
lgdafsmnhidvscctksgcnhpd

SCOPe Domain Coordinates for d2fd6u2:

Click to download the PDB-style file with coordinates for d2fd6u2.
(The format of our PDB-style files is described here.)

Timeline for d2fd6u2: