Lineage for d2fd6u2 (2fd6 U:189-275)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032361Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 3032435Protein Urokinase plasminogen activator surface receptor uPAR [161128] (1 species)
    duplication: tandem repeat of three similar domains; the N-terminal and C-terminal domains belong to Pfam PF00021; uPAR/Ly6
  7. 3032436Species Human (Homo sapiens) [TaxId:9606] [161129] (7 PDB entries)
    Uniprot Q03405 109-209! Uniprot Q03405 210-299! Uniprot Q03405 23-108
  8. 3032438Domain d2fd6u2: 2fd6 U:189-275 [145160]
    Other proteins in same PDB: d2fd6a1, d2fd6a2, d2fd6h1, d2fd6h2, d2fd6l1, d2fd6l2
    complexed with edo, etx, ndg, pg4, pge, so4

Details for d2fd6u2

PDB Entry: 2fd6 (more details), 1.9 Å

PDB Description: structure of human urokinase plasminogen activator in complex with urokinase receptor and an anti-upar antibody at 1.9 a
PDB Compounds: (U:) Urokinase plasminogen activator surface receptor

SCOPe Domain Sequences for d2fd6u2:

Sequence, based on SEQRES records: (download)

>d2fd6u2 g.7.1.3 (U:189-275) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]}
qngrqcysckgnsthgcsseetflidcrgpmnqclvatgthepknqsymvrgcatasmcq
hahlgdafsmnhidvscctksgcnhpd

Sequence, based on observed residues (ATOM records): (download)

>d2fd6u2 g.7.1.3 (U:189-275) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]}
qngrqcysckgnsthgcsseetflidcrgpmnqclvatgthepknqsymvrgcatasmcq
lgdafsmnhidvscctksgcnhpd

SCOPe Domain Coordinates for d2fd6u2:

Click to download the PDB-style file with coordinates for d2fd6u2.
(The format of our PDB-style files is described here.)

Timeline for d2fd6u2: