| Class g: Small proteins [56992] (90 folds) |
| Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
| Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (7 proteins) |
| Protein Urokinase plasminogen activator surface receptor, UPAR [161130] (1 species) duplication; comprises three domains of this fold |
| Species Human (Homo sapiens) [TaxId:9606] [161131] (4 PDB entries) Uniprot Q03405 111-210! Uniprot Q03405 114-210! Uniprot Q03405 211-297! Uniprot Q03405 211-301! Uniprot Q03405 23-102! Uniprot Q03405 23-104 |
| Domain d2fd6u1: 2fd6 U:1-80 [145159] Other proteins in same PDB: d2fd6a1, d2fd6a2, d2fd6h1, d2fd6h2, d2fd6l1, d2fd6l2 complexed with edo, etx, nag, ndg, pg4, pge, so4 |
PDB Entry: 2fd6 (more details), 1.9 Å
SCOPe Domain Sequences for d2fd6u1:
Sequence, based on SEQRES records: (download)
>d2fd6u1 g.7.1.3 (U:1-80) Urokinase plasminogen activator surface receptor, UPAR {Human (Homo sapiens) [TaxId: 9606]}
lrcmqcktngdcrveecalgqdlcrttivrlweegeelelvekscthsektnrtlsyrtg
lkitsltevvcgldlcnqgn
>d2fd6u1 g.7.1.3 (U:1-80) Urokinase plasminogen activator surface receptor, UPAR {Human (Homo sapiens) [TaxId: 9606]}
lrcmqcktngdcrveecalgqdlcrttivrlweelelvekscthsektnrtlsyrtglki
tsltevvcgldlcnqgn
Timeline for d2fd6u1: