Lineage for d2f9zc1 (2f9z C:1-157)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005836Fold d.194: CNF1/YfiH-like putative cysteine hydrolases [64437] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets
  4. 3005837Superfamily d.194.1: CNF1/YfiH-like putative cysteine hydrolases [64438] (3 families) (S)
  5. 3005871Family d.194.1.3: CheD-like [160883] (1 protein)
    Pfam PF03975
  6. 3005872Protein Chemoreceptor glutamine deamidase CheD [160884] (1 species)
  7. 3005873Species Thermotoga maritima [TaxId:2336] [160885] (1 PDB entry)
    Uniprot Q9X005 1-157
  8. 3005874Domain d2f9zc1: 2f9z C:1-157 [145153]
    Other proteins in same PDB: d2f9za_, d2f9zb_, d2f9zc2, d2f9zd3

Details for d2f9zc1

PDB Entry: 2f9z (more details), 2.4 Å

PDB Description: complex between the chemotaxis deamidase ched and the chemotaxis phosphatase chec from thermotoga maritima
PDB Compounds: (C:) PROTEIN (chemotaxis methylation protein)

SCOPe Domain Sequences for d2f9zc1:

Sequence, based on SEQRES records: (download)

>d2f9zc1 d.194.1.3 (C:1-157) Chemoreceptor glutamine deamidase CheD {Thermotoga maritima [TaxId: 2336]}
mkkvigigeyavmknpgvivtlglgscvavcmrdpvakvgamahvmlpdsggktdkpgky
adtavktlveelkkmgakverleakiaggasmfeskgmnigarnveavkkhlkdfgikll
aedtggnrarsveynietgkllvrkvgggeqleikei

Sequence, based on observed residues (ATOM records): (download)

>d2f9zc1 d.194.1.3 (C:1-157) Chemoreceptor glutamine deamidase CheD {Thermotoga maritima [TaxId: 2336]}
mkkvigigeyavmknpgvivtlglgscvavcmrdpvakvgamahvmlpdsggktdkpgky
adtavktlveelkkmgakverleakiaggasmfeskgmnigarnveavkkhlkdfgikll
aedtggnrarsveynietgkllvrkvleikei

SCOPe Domain Coordinates for d2f9zc1:

Click to download the PDB-style file with coordinates for d2f9zc1.
(The format of our PDB-style files is described here.)

Timeline for d2f9zc1: