SCOP 1.75: Domain d2f54l1: 2f54 L:1-112

Lineage for d2f54l1 (2f54 L:1-112)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (30 PDB entries)

8. Domain d2f54l1: 2f54 L:1-112 [145148]
   Other proteins in same PDB: d2f54a1, d2f54a2, d2f54b1, d2f54d2, d2f54e2, d2f54f1, d2f54f2, d2f54g1, d2f54k2, d2f54l2
   automatically matched to 2BNQ E:2-113
   mutant

Details for d2f54l1

PDB Entry: 2f54, 2.7 Å

PDB Description: directed evolution of human t cell receptor cdr2 residues by phage display dramatically enhances affinity for cognate peptide-mhc without increasing apparent cross-reactivity

PDB Compounds: (L:) T-cell receptor beta chain

SCOP Domain Sequences for d2f54l1:

Sequence; same for both SEQRES and ATOM records:

>d2f54l1 b.1.1.1 (L:1-112) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn
gynvsrsttedfplrllsaapsqtsvyfcassyvgntgelffgegsrltvle

Timeline for d2f54l1:

• d2f54l1 is new in SCOP 1.75
  
• d2f54l1 appears in SCOPe 2.01
  
• d2f54l1 appears in the current release, SCOPe 2.08