Lineage for d2f54k2 (2f54 K:115-205)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029022Protein T-cell antigen receptor [49125] (7 species)
  7. 2029023Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (24 PDB entries)
  8. 2029041Domain d2f54k2: 2f54 K:115-205 [145147]
    Other proteins in same PDB: d2f54a1, d2f54a2, d2f54b2, d2f54b3, d2f54d1, d2f54e1, d2f54f1, d2f54f2, d2f54g2, d2f54g3, d2f54k1, d2f54l1
    automatically matched to 2F54 D:115-205

Details for d2f54k2

PDB Entry: 2f54 (more details), 2.7 Å

PDB Description: directed evolution of human t cell receptor cdr2 residues by phage display dramatically enhances affinity for cognate peptide-mhc without increasing apparent cross-reactivity
PDB Compounds: (K:) T-cell receptor alpha chain

SCOPe Domain Sequences for d2f54k2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f54k2 b.1.1.2 (K:115-205) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpspe

SCOPe Domain Coordinates for d2f54k2:

Click to download the PDB-style file with coordinates for d2f54k2.
(The format of our PDB-style files is described here.)

Timeline for d2f54k2: