Lineage for d2f54k1 (2f54 K:1-114)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741896Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 2741897Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (21 PDB entries)
  8. 2741908Domain d2f54k1: 2f54 K:1-114 [145146]
    Other proteins in same PDB: d2f54a1, d2f54a2, d2f54b2, d2f54b3, d2f54d2, d2f54e2, d2f54f1, d2f54f2, d2f54g2, d2f54g3, d2f54k2, d2f54l2
    automatically matched to 2F54 D:1-114

Details for d2f54k1

PDB Entry: 2f54 (more details), 2.7 Å

PDB Description: directed evolution of human t cell receptor cdr2 residues by phage display dramatically enhances affinity for cognate peptide-mhc without increasing apparent cross-reactivity
PDB Compounds: (K:) T-cell receptor alpha chain

SCOPe Domain Sequences for d2f54k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f54k1 b.1.1.1 (K:1-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
qqvtqipaalsvpegenlvlncsftdsaiynlqwfrqdpggkltsllliqssqreqtsgr
lnasldksagsstlyiaasqpgdsatylcavrptsggsyiptfgrgtslivhpy

SCOPe Domain Coordinates for d2f54k1:

Click to download the PDB-style file with coordinates for d2f54k1.
(The format of our PDB-style files is described here.)

Timeline for d2f54k1: