Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein T-cell antigen receptor [49125] (6 species) |
Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (28 PDB entries) |
Domain d2f54e2: 2f54 E:113-241 [145145] Other proteins in same PDB: d2f54a1, d2f54a2, d2f54b1, d2f54d1, d2f54e1, d2f54f1, d2f54f2, d2f54g1, d2f54k1, d2f54l1 automatically matched to 2BNQ E:114-242 mutant |
PDB Entry: 2f54 (more details), 2.7 Å
SCOP Domain Sequences for d2f54e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f54e2 b.1.1.2 (E:113-241) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgrad
Timeline for d2f54e2: