Lineage for d2f54e2 (2f54 E:113-241)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 786831Protein T-cell antigen receptor [49125] (6 species)
  7. 786857Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (28 PDB entries)
  8. 786874Domain d2f54e2: 2f54 E:113-241 [145145]
    Other proteins in same PDB: d2f54a1, d2f54a2, d2f54b1, d2f54d1, d2f54e1, d2f54f1, d2f54f2, d2f54g1, d2f54k1, d2f54l1
    automatically matched to 2BNQ E:114-242
    mutant

Details for d2f54e2

PDB Entry: 2f54 (more details), 2.7 Å

PDB Description: directed evolution of human t cell receptor cdr2 residues by phage display dramatically enhances affinity for cognate peptide-mhc without increasing apparent cross-reactivity
PDB Compounds: (E:) T-cell receptor beta chain

SCOP Domain Sequences for d2f54e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f54e2 b.1.1.2 (E:113-241) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOP Domain Coordinates for d2f54e2:

Click to download the PDB-style file with coordinates for d2f54e2.
(The format of our PDB-style files is described here.)

Timeline for d2f54e2: