SCOPe 2.08: Domain d2f54e2: 2f54 E:113-241

Lineage for d2f54e2 (2f54 E:113-241)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (46 PDB entries)

8. Domain d2f54e2: 2f54 E:113-241 [145145]
   Other proteins in same PDB: d2f54a1, d2f54a2, d2f54b2, d2f54b3, d2f54d1, d2f54e1, d2f54f1, d2f54f2, d2f54g2, d2f54g3, d2f54k1, d2f54l1
   automatically matched to 2BNQ E:114-242

Details for d2f54e2

PDB Entry: 2f54, 2.7 Å

PDB Description: directed evolution of human t cell receptor cdr2 residues by phage display dramatically enhances affinity for cognate peptide-mhc without increasing apparent cross-reactivity

PDB Compounds: (E:) T-cell receptor beta chain

SCOPe Domain Sequences for d2f54e2:

Sequence; same for both SEQRES and ATOM records:

>d2f54e2 b.1.1.2 (E:113-241) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d2f54e2:

• d2f54e2 first appeared in SCOP 1.75
  
• d2f54e2 appears in SCOPe 2.07