SCOPe 2.02: Domain d2f53e1: 2f53 E:1-112

Lineage for d2f53e1 (2f53 E:1-112)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (30 PDB entries)

8. Domain d2f53e1: 2f53 E:1-112 [145140]
   Other proteins in same PDB: d2f53a1, d2f53a2, d2f53b1, d2f53d2, d2f53e2
   complexed with gol, na

Details for d2f53e1

PDB Entry: 2f53, 2.1 Å

PDB Description: directed evolution of human t-cell receptor cdr2 residues by phage display dramatically enhances affinity for cognate peptide-mhc without apparent cross-reactivity

PDB Compounds: (E:) T-cell receptor, beta chain

SCOPe Domain Sequences for d2f53e1:

Sequence; same for both SEQRES and ATOM records:

>d2f53e1 b.1.1.1 (E:1-112) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvsvgmtdqgevpn
gynvsrsttedfplrllsaapsqtsvyfcassyvgntgelffgegsrltvle

Timeline for d2f53e1:

• d2f53e1 first appeared in SCOP 1.75
  
• d2f53e1 appears in SCOPe 2.01
  
• d2f53e1 appears in SCOPe 2.03
  
• d2f53e1 appears in the current release, SCOPe 2.08