SCOPe 2.08: Domain d2f53d2: 2f53 D:115-191

Lineage for d2f53d2 (2f53 D:115-191)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (26 PDB entries)

8. Domain d2f53d2: 2f53 D:115-191 [145139]
   Other proteins in same PDB: d2f53a1, d2f53a2, d2f53b1, d2f53b2, d2f53d1, d2f53e1
   complexed with gol, na
   missing some secondary structures that made up less than one-third of the common domain

Details for d2f53d2

PDB Entry: 2f53, 2.1 Å

PDB Description: directed evolution of human t-cell receptor cdr2 residues by phage display dramatically enhances affinity for cognate peptide-mhc without apparent cross-reactivity

PDB Compounds: (D:) T-cell receptor, alpha chain

SCOPe Domain Sequences for d2f53d2:

Sequence; same for both SEQRES and ATOM records:

>d2f53d2 b.1.1.2 (D:115-191) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafn

Timeline for d2f53d2:

• d2f53d2 first appeared in SCOP 1.75
  
• d2f53d2 appears in SCOPe 2.07