| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
| Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (21 PDB entries) |
| Domain d2f53d1: 2f53 D:1-114 [145138] Other proteins in same PDB: d2f53a1, d2f53a2, d2f53b1, d2f53b2, d2f53d2, d2f53e2 complexed with gol, na |
PDB Entry: 2f53 (more details), 2.1 Å
SCOPe Domain Sequences for d2f53d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f53d1 b.1.1.1 (D:1-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
qevtqipaalsvpegenlvlncsftdsaiynlqwfrqdpgkgltslllipfwqreqtsgr
lnasldkssgrstlyiaasqpgdsatylcavrptsggsyiptfgrgtslivhpy
Timeline for d2f53d1: