SCOPe 2.05: Domain d2f4oa_: 2f4o A:

Lineage for d2f4oa_ (2f4o A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.4: Transglutaminase core [54044] (3 proteins)

6. Protein automated matches [190634] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187686] (1 PDB entry)

8. Domain d2f4oa_: 2f4o A: [145136]
   Other proteins in same PDB: d2f4ob_
   automated match to d2f4ma1
   complexed with cl, zn

Details for d2f4oa_

PDB Entry: 2f4o, 2.26 Å

PDB Description: the mouse pngase-hr23 complex reveals a complete remodulation of the protein-protein interface compared to its yeast orthologs

PDB Compounds: (A:) peptide N-glycanase

SCOPe Domain Sequences for d2f4oa_:

Sequence, based on SEQRES records:

>d2f4oa_ d.3.1.4 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gdstilkvlqsniqhvqlyenpvlqekaltcipvselkrkaqeklfrarkldkgtnvsde
dflllellhwfkeeffrwvnnivcskcggetrsrdeallpnddelkwgaknvenhycdac
qlsnrfprynnpeklletrcgrcgewancftlccralgfearyvwdytdhvwtevyspsq
qrwlhcdacedvcdkpllyeigwgkklsyiiafskdevvdvtwrysckhdevmsrrtkvk
eellretinglnkqrqlslsesrrkellqriivelvefispktprpglehhhhhh

Sequence, based on observed residues (ATOM records):

>d2f4oa_ d.3.1.4 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gdstilkvlqsniqhvqlyenpvlqekaltcipvselkrkaqeklfrarkldkgtnvsde
dflllellhwfkeeffrwvnnivcskcggetrsrdeallpnddelkwgaknvenhycdac
qlsnrfprynnpeklletrcgrcgewancftlccralgfearyvwdytdhvwtevyspsq
qrwlhcdacedvcdkpllyeigwgkklsyiiafskdevvdvtwrysckhdevmsrrtkvk
eellretinglnkqrqlslsesrrkellqriivelvefispktphhhhhh

Timeline for d2f4oa_:

• d2f4oa_ first appeared in SCOP 1.75, called d2f4oa1
  
• d2f4oa_ appears in SCOPe 2.04
  
• d2f4oa_ is called d2f4oa2 in SCOPe 2.06
  
• d2f4oa_ appears in the current release, SCOPe 2.08, called d2f4oa2