Lineage for d2f4oa_ (2f4o A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1014844Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1014845Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1015240Family d.3.1.4: Transglutaminase core [54044] (3 proteins)
  6. 1015284Protein automated matches [190634] (2 species)
    not a true protein
  7. 1015287Species Mouse (Mus musculus) [TaxId:10090] [187686] (1 PDB entry)
  8. 1015288Domain d2f4oa_: 2f4o A: [145136]
    Other proteins in same PDB: d2f4ob_
    automated match to d2f4ma1
    complexed with cl, zn

Details for d2f4oa_

PDB Entry: 2f4o (more details), 2.26 Å

PDB Description: the mouse pngase-hr23 complex reveals a complete remodulation of the protein-protein interface compared to its yeast orthologs
PDB Compounds: (A:) peptide N-glycanase

SCOPe Domain Sequences for d2f4oa_:

Sequence, based on SEQRES records: (download)

>d2f4oa_ d.3.1.4 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gdstilkvlqsniqhvqlyenpvlqekaltcipvselkrkaqeklfrarkldkgtnvsde
dflllellhwfkeeffrwvnnivcskcggetrsrdeallpnddelkwgaknvenhycdac
qlsnrfprynnpeklletrcgrcgewancftlccralgfearyvwdytdhvwtevyspsq
qrwlhcdacedvcdkpllyeigwgkklsyiiafskdevvdvtwrysckhdevmsrrtkvk
eellretinglnkqrqlslsesrrkellqriivelvefispktprpglehhhhhh

Sequence, based on observed residues (ATOM records): (download)

>d2f4oa_ d.3.1.4 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gdstilkvlqsniqhvqlyenpvlqekaltcipvselkrkaqeklfrarkldkgtnvsde
dflllellhwfkeeffrwvnnivcskcggetrsrdeallpnddelkwgaknvenhycdac
qlsnrfprynnpeklletrcgrcgewancftlccralgfearyvwdytdhvwtevyspsq
qrwlhcdacedvcdkpllyeigwgkklsyiiafskdevvdvtwrysckhdevmsrrtkvk
eellretinglnkqrqlslsesrrkellqriivelvefispktphhhhhh

SCOPe Domain Coordinates for d2f4oa_:

Click to download the PDB-style file with coordinates for d2f4oa_.
(The format of our PDB-style files is described here.)

Timeline for d2f4oa_: