Lineage for d2f4oa2 (2f4o A:164-447)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927111Family d.3.1.4: Transglutaminase core [54044] (3 proteins)
  6. 2927174Protein automated matches [190634] (3 species)
    not a true protein
  7. 2927180Species Mouse (Mus musculus) [TaxId:10090] [187686] (1 PDB entry)
  8. 2927181Domain d2f4oa2: 2f4o A:164-447 [145136]
    Other proteins in same PDB: d2f4oa3, d2f4ob2, d2f4ob3
    automated match to d2f4ma1
    complexed with cl, zn

Details for d2f4oa2

PDB Entry: 2f4o (more details), 2.26 Å

PDB Description: the mouse pngase-hr23 complex reveals a complete remodulation of the protein-protein interface compared to its yeast orthologs
PDB Compounds: (A:) peptide N-glycanase

SCOPe Domain Sequences for d2f4oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f4oa2 d.3.1.4 (A:164-447) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gdstilkvlqsniqhvqlyenpvlqekaltcipvselkrkaqeklfrarkldkgtnvsde
dflllellhwfkeeffrwvnnivcskcggetrsrdeallpnddelkwgaknvenhycdac
qlsnrfprynnpeklletrcgrcgewancftlccralgfearyvwdytdhvwtevyspsq
qrwlhcdacedvcdkpllyeigwgkklsyiiafskdevvdvtwrysckhdevmsrrtkvk
eellretinglnkqrqlslsesrrkellqriivelvefispktp

SCOPe Domain Coordinates for d2f4oa2:

Click to download the PDB-style file with coordinates for d2f4oa2.
(The format of our PDB-style files is described here.)

Timeline for d2f4oa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f4oa3