Lineage for d2f43g1 (2f43 G:4-273)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2880867Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 2881030Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) (S)
    contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold
  5. 2881031Family c.49.2.1: ATP synthase (F1-ATPase), gamma subunit [52944] (1 protein)
    automatically mapped to Pfam PF00231
  6. 2881032Protein F1 ATP synthase gamma subunit [52945] (4 species)
  7. 2881072Species Norway rat (Rattus norvegicus) [TaxId:10116] [52947] (2 PDB entries)
  8. 2881074Domain d2f43g1: 2f43 G:4-273 [145134]
    Other proteins in same PDB: d2f43a1, d2f43a2, d2f43a3, d2f43b1, d2f43b2, d2f43b3
    partly disordered in the crystal
    complexed with adp, atp, mg, vo4
    fragment; missing more than one-third of the common structure and/or sequence

Details for d2f43g1

PDB Entry: 2f43 (more details), 3 Å

PDB Description: Rat liver F1-ATPase
PDB Compounds: (G:) ATP synthase gamma chain, mitochondrial

SCOPe Domain Sequences for d2f43g1:

Sequence, based on SEQRES records: (download)

>d2f43g1 c.49.2.1 (G:4-273) F1 ATP synthase gamma subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kditrrlksikniqkitksmkmvaaakyaraerelkparvygtgslalyekaeikgpedk
kkhliigvssdrglcgaihssvakqmkndmaaltaagkevmivgigekiksilyrthsdq
flvsfkdvgrkpptfgdasvialellnsgyefdegsiifnqfksvisykteekpifsfst
vvaaenmsiyddidadvlqnyqeynlaniiyyslkesttseqsarmtamdnasknasdmi
dkltltfnrtrqavitkelieiisgaaald

Sequence, based on observed residues (ATOM records): (download)

>d2f43g1 c.49.2.1 (G:4-273) F1 ATP synthase gamma subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kditrrlksikniqkitksmkmvaaakyaraerelkparvygtgslcgaihssvakqmkl
aniiyyslkesttseqsarmtamdnasknasdmidkltltfnrtrqavitkelieiisga
aald

SCOPe Domain Coordinates for d2f43g1:

Click to download the PDB-style file with coordinates for d2f43g1.
(The format of our PDB-style files is described here.)

Timeline for d2f43g1: