Lineage for d2f43a3 (2f43 A:95-379)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869423Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2869998Protein automated matches [190393] (12 species)
    not a true protein
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [255163] (1 PDB entry)
  8. 2870087Domain d2f43a3: 2f43 A:95-379 [145133]
    Other proteins in same PDB: d2f43a1, d2f43a2, d2f43b1, d2f43b2, d2f43g1
    automated match to d1maba3
    complexed with adp, atp, mg, vo4

Details for d2f43a3

PDB Entry: 2f43 (more details), 3 Å

PDB Description: Rat liver F1-ATPase
PDB Compounds: (A:) ATP synthase alpha chain, mitochondrial

SCOPe Domain Sequences for d2f43a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f43a3 c.37.1.11 (A:95-379) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vdvpvgdellgrvvdalgnaidgkgpvgskirrrvglkapgiiprisvrepmqtgikavd
slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva
qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq
avayrqmslllrrppgreaypgdvfylhsrlleraakmndsfgggsltalpvietqagdv
sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq

SCOPe Domain Coordinates for d2f43a3:

Click to download the PDB-style file with coordinates for d2f43a3.
(The format of our PDB-style files is described here.)

Timeline for d2f43a3: