Lineage for d2f43a2 (2f43 A:23-94)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1320662Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 1320663Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
    automatically mapped to Pfam PF02874
  5. 1320664Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 1320665Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species)
  7. 1320714Species Norway rat (Rattus norvegicus) [TaxId:10116] [88674] (2 PDB entries)
  8. 1320716Domain d2f43a2: 2f43 A:23-94 [145132]
    Other proteins in same PDB: d2f43a1, d2f43a3, d2f43b1, d2f43b2, d2f43b3, d2f43g1
    automatically matched to d1maba2
    complexed with adp, atp, mg, vo4

Details for d2f43a2

PDB Entry: 2f43 (more details), 3 Å

PDB Description: Rat liver F1-ATPase
PDB Compounds: (A:) ATP synthase alpha chain, mitochondrial

SCOPe Domain Sequences for d2f43a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f43a2 b.49.1.1 (A:23-94) F1 ATP synthase alpha subunit, domain 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndkli
kegdivkrtgai

SCOPe Domain Coordinates for d2f43a2:

Click to download the PDB-style file with coordinates for d2f43a2.
(The format of our PDB-style files is described here.)

Timeline for d2f43a2: