![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
![]() | Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (2 families) ![]() |
![]() | Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
![]() | Protein automated matches [254528] (6 species) not a true protein |
![]() | Domain d2f43a1: 2f43 A:380-502 [145131] Other proteins in same PDB: d2f43a2, d2f43a3, d2f43b2, d2f43b3, d2f43g1 automated match to d1maba1 complexed with adp, atp, mg, vo4 |
PDB Entry: 2f43 (more details), 3 Å
SCOPe Domain Sequences for d2f43a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f43a1 a.69.1.0 (A:380-502) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie eqvaviyagvrgyldklepskitkfesaflshvvsqhqsllgnirsdgkiseqsdaklke ivt
Timeline for d2f43a1:
![]() Domains from other chains: (mouse over for more information) d2f43b1, d2f43b2, d2f43b3, d2f43g1 |