Lineage for d2f43a1 (2f43 A:380-502)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1273476Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 1273477Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 1273478Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 1273479Protein F1 ATP synthase alpha subunit, domain 3 [88886] (4 species)
  7. 1273528Species Norway rat (Rattus norvegicus) [TaxId:10116] [88925] (2 PDB entries)
  8. 1273530Domain d2f43a1: 2f43 A:380-502 [145131]
    Other proteins in same PDB: d2f43a2, d2f43a3, d2f43b1, d2f43b2, d2f43b3, d2f43g1
    automatically matched to d1maba1
    complexed with adp, atp, mg, vo4

Details for d2f43a1

PDB Entry: 2f43 (more details), 3 Å

PDB Description: Rat liver F1-ATPase
PDB Compounds: (A:) ATP synthase alpha chain, mitochondrial

SCOPe Domain Sequences for d2f43a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f43a1 a.69.1.1 (A:380-502) F1 ATP synthase alpha subunit, domain 3 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfesaflshvvsqhqsllgnirsdgkiseqsdaklke
ivt

SCOPe Domain Coordinates for d2f43a1:

Click to download the PDB-style file with coordinates for d2f43a1.
(The format of our PDB-style files is described here.)

Timeline for d2f43a1: