Lineage for d2f43a1 (2f43 A:380-502)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717538Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 2717539Protein automated matches [254528] (17 species)
    not a true protein
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [255164] (1 PDB entry)
  8. 2717659Domain d2f43a1: 2f43 A:380-502 [145131]
    Other proteins in same PDB: d2f43a2, d2f43a3, d2f43b2, d2f43b3, d2f43g1
    automated match to d1maba1
    complexed with adp, atp, mg, vo4

Details for d2f43a1

PDB Entry: 2f43 (more details), 3 Å

PDB Description: Rat liver F1-ATPase
PDB Compounds: (A:) ATP synthase alpha chain, mitochondrial

SCOPe Domain Sequences for d2f43a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f43a1 a.69.1.0 (A:380-502) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfesaflshvvsqhqsllgnirsdgkiseqsdaklke
ivt

SCOPe Domain Coordinates for d2f43a1:

Click to download the PDB-style file with coordinates for d2f43a1.
(The format of our PDB-style files is described here.)

Timeline for d2f43a1: