Lineage for d2f3ci1 (2f3c I:5-50)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038435Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 3038436Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 3038437Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)
  6. 3038441Protein Blood-sucking insect-derived tryptase inhibitor [57476] (2 species)
    duplication: contains two domains of this fold
  7. 3038451Species Triatoma infestans [TaxId:30076] [161138] (2 PDB entries)
    Uniprot Q95P16 170-222! Uniprot Q95P16 5-50
    infestin
  8. 3038453Domain d2f3ci1: 2f3c I:5-50 [145130]
    Other proteins in same PDB: d2f3ce_
    infestin 1
    complexed with ca, so4

Details for d2f3ci1

PDB Entry: 2f3c (more details), 2.5 Å

PDB Description: crystal structure of infestin 1, a kazal-type serineprotease inhibitor, in complex with trypsin
PDB Compounds: (I:) thrombin inhibitor infestin

SCOPe Domain Sequences for d2f3ci1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f3ci1 g.68.1.1 (I:5-50) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]}
dcacprvlhrvcgsdgntysnpctldcakhegkpdlvqvhegpcdp

SCOPe Domain Coordinates for d2f3ci1:

Click to download the PDB-style file with coordinates for d2f3ci1.
(The format of our PDB-style files is described here.)

Timeline for d2f3ci1: