![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily) |
![]() | Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) ![]() conserved core consists of a helix and a loop crosslinked with two disulfides |
![]() | Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins) |
![]() | Protein Blood-sucking insect-derived tryptase inhibitor [57476] (2 species) duplication: contains two domains of this fold |
![]() | Species Triatoma infestans [TaxId:30076] [161138] (2 PDB entries) Uniprot Q95P16 170-222! Uniprot Q95P16 5-50 infestin |
![]() | Domain d2f3ci1: 2f3c I:5-50 [145130] Other proteins in same PDB: d2f3ce_ infestin 1 complexed with ca, so4 |
PDB Entry: 2f3c (more details), 2.5 Å
SCOPe Domain Sequences for d2f3ci1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f3ci1 g.68.1.1 (I:5-50) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} dcacprvlhrvcgsdgntysnpctldcakhegkpdlvqvhegpcdp
Timeline for d2f3ci1: