| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein T-cell antigen receptor [49125] (6 species) |
| Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (16 PDB entries) |
| Domain d2esvd2: 2esv D:117-205 [145125] Other proteins in same PDB: d2esva1, d2esva2, d2esvb_, d2esvd1, d2esve1 complexed with iod |
PDB Entry: 2esv (more details), 2.6 Å
SCOPe Domain Sequences for d2esvd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2esvd2 b.1.1.2 (D:117-205) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps
Timeline for d2esvd2: