Lineage for d2esvd1 (2esv D:4-116)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023718Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 2023719Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (21 PDB entries)
  8. 2023731Domain d2esvd1: 2esv D:4-116 [145124]
    Other proteins in same PDB: d2esva1, d2esva2, d2esvb2, d2esvb3, d2esvd2, d2esve2
    complexed with iod

Details for d2esvd1

PDB Entry: 2esv (more details), 2.6 Å

PDB Description: structure of the hla-e-vmaprtlil/kk50.4 tcr complex
PDB Compounds: (D:) KK50.4 T cell receptor alpha chain

SCOPe Domain Sequences for d2esvd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2esvd1 b.1.1.1 (D:4-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
kttqppsmdcaegraanlpcnhstisgneyvywyrqihsqgpqyiihglknnetnemasl
iitedrksstlilphatlrdtavyycivvrssntgklifgqgttlqvkpd

SCOPe Domain Coordinates for d2esvd1:

Click to download the PDB-style file with coordinates for d2esvd1.
(The format of our PDB-style files is described here.)

Timeline for d2esvd1: