| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
| Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (21 PDB entries) |
| Domain d2esvd1: 2esv D:4-116 [145124] Other proteins in same PDB: d2esva1, d2esva2, d2esvb2, d2esvb3, d2esvd2, d2esve2 complexed with iod |
PDB Entry: 2esv (more details), 2.6 Å
SCOPe Domain Sequences for d2esvd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2esvd1 b.1.1.1 (D:4-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
kttqppsmdcaegraanlpcnhstisgneyvywyrqihsqgpqyiihglknnetnemasl
iitedrksstlilphatlrdtavyycivvrssntgklifgqgttlqvkpd
Timeline for d2esvd1: