Lineage for d2es4e_ (2es4 E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2346684Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2347191Superfamily a.137.15: Lipase chaperone-like [158855] (1 family) (S)
    open single layer scaffold of 11 helices, which engulfs the substrate protein
  5. 2347192Family a.137.15.1: Lipase chaperone LifO-like [158856] (1 protein)
    Pfam PF03280
  6. 2347193Protein Lipase chaperone LifO (LipB) [158857] (1 species)
  7. 2347194Species Burkholderia glumae [TaxId:337] [158858] (1 PDB entry)
    Uniprot Q05490 73-352
  8. 2347196Domain d2es4e_: 2es4 E: [145123]
    Other proteins in same PDB: d2es4a_, d2es4b_
    automated match to d2es4d1
    complexed with ca, iod

Details for d2es4e_

PDB Entry: 2es4 (more details), 1.85 Å

PDB Description: crystal structure of the burkholderia glumae lipase-specific foldase in complex with its cognate lipase
PDB Compounds: (E:) Lipase chaperone

SCOPe Domain Sequences for d2es4e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2es4e_ a.137.15.1 (E:) Lipase chaperone LifO (LipB) {Burkholderia glumae [TaxId: 337]}
mplpaalpgalagshaprlplaaggrlartravreffdycltaqgeltpaaldalvrrei
aaqldgspaqaealgvwrryrayfdalaqlpgdgavlgdkldpaamqlaldqraaladrt
lgewaepffgdeqrrqrhdleririandttlspeqkaarlaaldaqltpderaqqaalha
qqdavtkiadlqkagatpdqmraqiaqtlgpeaaaraaqmqqddeawqtryqayaaerdr
iaaqglapqdrdariaqlrqqtftapgeairaasldrg

SCOPe Domain Coordinates for d2es4e_:

Click to download the PDB-style file with coordinates for d2es4e_.
(The format of our PDB-style files is described here.)

Timeline for d2es4e_: