SCOPe 2.01: Domain d2es4e1: 2es4 E:53-330

Lineage for d2es4e1 (2es4 E:53-330)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.15: Lipase chaperone-like [158855] (1 family)
   open single layer scaffold of 11 helices, which engulfs the substrate protein

5. Family a.137.15.1: Lipase chaperone LifO-like [158856] (1 protein)
   Pfam PF03280

6. Protein Lipase chaperone LifO (LipB) [158857] (1 species)

7. Species Burkholderia glumae [TaxId:337] [158858] (1 PDB entry)
   Uniprot Q05490 73-352

8. Domain d2es4e1: 2es4 E:53-330 [145123]
   Other proteins in same PDB: d2es4a_, d2es4b_
   automatically matched to 2ES4 D:53-332
   complexed with ca, iod

Details for d2es4e1

PDB Entry: 2es4, 1.85 Å

PDB Description: crystal structure of the burkholderia glumae lipase-specific foldase in complex with its cognate lipase

PDB Compounds: (E:) Lipase chaperone

SCOPe Domain Sequences for d2es4e1:

Sequence; same for both SEQRES and ATOM records:

>d2es4e1 a.137.15.1 (E:53-330) Lipase chaperone LifO (LipB) {Burkholderia glumae [TaxId: 337]}
mplpaalpgalagshaprlplaaggrlartravreffdycltaqgeltpaaldalvrrei
aaqldgspaqaealgvwrryrayfdalaqlpgdgavlgdkldpaamqlaldqraaladrt
lgewaepffgdeqrrqrhdleririandttlspeqkaarlaaldaqltpderaqqaalha
qqdavtkiadlqkagatpdqmraqiaqtlgpeaaaraaqmqqddeawqtryqayaaerdr
iaaqglapqdrdariaqlrqqtftapgeairaasldrg

Timeline for d2es4e1:

• d2es4e1 first appeared in SCOP 1.75
  
• d2es4e1 appears in SCOPe 2.02
  
• d2es4e1 appears in the current release, SCOPe 2.08, called d2es4e_