![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.137.15: Lipase chaperone-like [158855] (1 family) ![]() open single layer scaffold of 11 helices, which engulfs the substrate protein |
![]() | Family a.137.15.1: Lipase chaperone LifO-like [158856] (1 protein) Pfam PF03280 |
![]() | Protein Lipase chaperone LifO (LipB) [158857] (1 species) |
![]() | Species Burkholderia glumae [TaxId:337] [158858] (1 PDB entry) Uniprot Q05490 73-352 |
![]() | Domain d2es4e_: 2es4 E: [145123] Other proteins in same PDB: d2es4a_, d2es4b_ automated match to d2es4d1 complexed with ca, iod |
PDB Entry: 2es4 (more details), 1.85 Å
SCOPe Domain Sequences for d2es4e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2es4e_ a.137.15.1 (E:) Lipase chaperone LifO (LipB) {Burkholderia glumae [TaxId: 337]} mplpaalpgalagshaprlplaaggrlartravreffdycltaqgeltpaaldalvrrei aaqldgspaqaealgvwrryrayfdalaqlpgdgavlgdkldpaamqlaldqraaladrt lgewaepffgdeqrrqrhdleririandttlspeqkaarlaaldaqltpderaqqaalha qqdavtkiadlqkagatpdqmraqiaqtlgpeaaaraaqmqqddeawqtryqayaaerdr iaaqglapqdrdariaqlrqqtftapgeairaasldrg
Timeline for d2es4e_: