Lineage for d2es4d1 (2es4 D:53-332)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012335Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2012592Superfamily a.137.15: Lipase chaperone-like [158855] (1 family) (S)
    open single layer scaffold of 11 helices, which engulfs the substrate protein
  5. 2012593Family a.137.15.1: Lipase chaperone LifO-like [158856] (1 protein)
    Pfam PF03280
  6. 2012594Protein Lipase chaperone LifO (LipB) [158857] (1 species)
  7. 2012595Species Burkholderia glumae [TaxId:337] [158858] (1 PDB entry)
    Uniprot Q05490 73-352
  8. 2012596Domain d2es4d1: 2es4 D:53-332 [145122]
    Other proteins in same PDB: d2es4a_, d2es4b_
    complexed with ca, iod

Details for d2es4d1

PDB Entry: 2es4 (more details), 1.85 Å

PDB Description: crystal structure of the burkholderia glumae lipase-specific foldase in complex with its cognate lipase
PDB Compounds: (D:) Lipase chaperone

SCOPe Domain Sequences for d2es4d1:

Sequence, based on SEQRES records: (download)

>d2es4d1 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) {Burkholderia glumae [TaxId: 337]}
mplpaalpgalagshaprlplaaggrlartravreffdycltaqgeltpaaldalvrrei
aaqldgspaqaealgvwrryrayfdalaqlpgdgavlgdkldpaamqlaldqraaladrt
lgewaepffgdeqrrqrhdleririandttlspeqkaarlaaldaqltpderaqqaalha
qqdavtkiadlqkagatpdqmraqiaqtlgpeaaaraaqmqqddeawqtryqayaaerdr
iaaqglapqdrdariaqlrqqtftapgeairaasldrgag

Sequence, based on observed residues (ATOM records): (download)

>d2es4d1 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) {Burkholderia glumae [TaxId: 337]}
mplpaalpgalagshaprlplaaggrlartravreffdycltaqgeltpaaldalvrrei
aaqldgspaqaealgvwrryrayfdalavlgdkldpaamqlaldqraaladrtlgewaep
ffgdeqrrqrhdleririandtlsqkaarlaaldaqltpderaqqaalhaqqdavtkiad
lqkagatpdqmraqiaqtlgpeaaaraaqmqqddeawqtryqayaaerdriaaqglapqd
rdariaqlrqqtftapgeairaasldrgag

SCOPe Domain Coordinates for d2es4d1:

Click to download the PDB-style file with coordinates for d2es4d1.
(The format of our PDB-style files is described here.)

Timeline for d2es4d1: