Lineage for d2eqbb1 (2eqb B:51-142)

  1. Root: SCOP 1.75
  2. 894739Class h: Coiled coil proteins [57942] (7 folds)
  3. 894740Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 895804Superfamily h.1.33: Sec2 N-terminal region [144284] (1 family) (S)
    dimeric coiled coil
  5. 895805Family h.1.33.1: Sec2 N-terminal region [144285] (1 protein)
  6. 895806Protein Rab guanine nucleotide exchange factor Sec2 [144286] (1 species)
  7. 895807Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [144287] (3 PDB entries)
    Uniprot P17065 16-162! Uniprot P17065 31-144
  8. 895828Domain d2eqbb1: 2eqb B:51-142 [145120]
    Other proteins in same PDB: d2eqba1
    complexed with po4

Details for d2eqbb1

PDB Entry: 2eqb (more details), 2.7 Å

PDB Description: Crystal structure of the Rab GTPase Sec4p, the Sec2p GEF domain, and phosphate complex
PDB Compounds: (B:) Rab guanine nucleotide exchange factor SEC2

SCOP Domain Sequences for d2eqbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eqbb1 h.1.33.1 (B:51-142) Rab guanine nucleotide exchange factor Sec2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nynqlkedyntlkrelsdrddevkrlrediakenelrtkaeeeadklnkevedltaslfd
eannmvadarkekyaieilnkrlteqlrekdt

SCOP Domain Coordinates for d2eqbb1:

Click to download the PDB-style file with coordinates for d2eqbb1.
(The format of our PDB-style files is described here.)

Timeline for d2eqbb1: