Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.24: PetL subunit of the cytochrome b6f complex [103436] (1 family) |
Family f.23.24.1: PetL subunit of the cytochrome b6f complex [103437] (1 protein) |
Protein PetL subunit of the cytochrome b6f complex [103438] (2 species) |
Species Mastigocladus laminosus [TaxId:83541] [103439] (7 PDB entries) |
Domain d2e75e1: 2e75 E:1-32 [145115] Other proteins in same PDB: d2e75a1, d2e75b1, d2e75d1, d2e75d2, d2e75f1, d2e75g1, d2e75h1 automatically matched to 2D2C E:1-32 complexed with bcr, cd, cla, fes, hem, opc, qno, sqd, umq |
PDB Entry: 2e75 (more details), 3.55 Å
SCOPe Domain Sequences for d2e75e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e75e1 f.23.24.1 (E:1-32) PetL subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]} milgavfyivfialffgiavgiifaiksikli
Timeline for d2e75e1: