Lineage for d2e75b1 (2e75 B:1-160)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027980Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 3027981Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. 3027982Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 3028029Protein Subunit IV of the cytochrome b6f complex [103495] (2 species)
  7. 3028032Species Mastigocladus laminosus [TaxId:83541] [103496] (8 PDB entries)
  8. 3028040Domain d2e75b1: 2e75 B:1-160 [145114]
    Other proteins in same PDB: d2e75a1, d2e75d1, d2e75d2, d2e75e1, d2e75f1, d2e75g1, d2e75h1
    automatically matched to 2E74 B:1-160
    complexed with bcr, cd, cla, fes, hem, opc, qno, sqd, umq

Details for d2e75b1

PDB Entry: 2e75 (more details), 3.55 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex with 2-nonyl-4-hydroxyquinoline N-oxide (NQNO) from M.laminosus
PDB Compounds: (B:) Cytochrome b6-f complex subunit 4

SCOPe Domain Sequences for d2e75b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e75b1 f.32.1.1 (B:1-160) Subunit IV of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
matlkkpdlsdpklraklakgmghnyygepawpndllyvfpvvimgtfacivalsvldpa
mvgepadpfatpleilpewylypvfqilrsvpnkllgvllmasvplglilvpfienvnkf
qnpfrrpvattiflfgtlvtiwlgigatfpldktltlglf

SCOPe Domain Coordinates for d2e75b1:

Click to download the PDB-style file with coordinates for d2e75b1.
(The format of our PDB-style files is described here.)

Timeline for d2e75b1: