| Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
| Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.24: PetL subunit of the cytochrome b6f complex [103436] (1 family) ![]() |
| Family f.23.24.1: PetL subunit of the cytochrome b6f complex [103437] (1 protein) |
| Protein PetL subunit of the cytochrome b6f complex [103438] (2 species) |
| Species Mastigocladus laminosus [TaxId:83541] [103439] (5 PDB entries) |
| Domain d2e74e1: 2e74 E:1-32 [145112] Other proteins in same PDB: d2e74a1, d2e74b1, d2e74d1, d2e74d2, d2e74f1, d2e74g1, d2e74h1 automatically matched to 2D2C E:1-32 complexed with bcr, cd, cla, fes, hem, opc, sqd, umq |
PDB Entry: 2e74 (more details), 3 Å
SCOP Domain Sequences for d2e74e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e74e1 f.23.24.1 (E:1-32) PetL subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
milgavfyivfialffgiavgiifaiksikli
Timeline for d2e74e1: