![]() | Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
![]() | Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily) core: three transmembrane helices, up-and-down bundle |
![]() | Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family) ![]() |
![]() | Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins) a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
![]() | Protein Subunit IV of the cytochrome b6f complex [103495] (2 species) |
![]() | Species Mastigocladus laminosus [TaxId:83541] [103496] (5 PDB entries) |
![]() | Domain d2e74b1: 2e74 B:1-160 [145111] Other proteins in same PDB: d2e74a1, d2e74d1, d2e74d2, d2e74e1, d2e74f1, d2e74g1, d2e74h1 complexed with bcr, cd, cla, fes, hem, opc, sqd, umq |
PDB Entry: 2e74 (more details), 3 Å
SCOP Domain Sequences for d2e74b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e74b1 f.32.1.1 (B:1-160) Subunit IV of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]} matlkkpdlsdpklraklakgmghnyygepawpndllyvfpvvimgtfacivalsvldpa mvgepadpfatpleilpewylypvfqilrsvpnkllgvllmasvplglilvpfienvnkf qnpfrrpvattiflfgtlvtiwlgigatfpldktltlglf
Timeline for d2e74b1: