Class g: Small proteins [56992] (94 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) |
Family g.3.9.1: Growth factor receptor domain [57185] (10 proteins) Pfam PF00757; Pfam PF14843; Pfam PF15913 |
Protein Insulin receptor [161122] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [161123] (1 PDB entry) Uniprot P06213 184-338 |
Domain d2dtge6: 2dtg E:157-311 [145105] Other proteins in same PDB: d2dtga1, d2dtgb1, d2dtgb2, d2dtgc1, d2dtgc2, d2dtgd1, d2dtge1, d2dtge2, d2dtge3, d2dtge4, d2dtge5 |
PDB Entry: 2dtg (more details), 3.8 Å
SCOPe Domain Sequences for d2dtge6:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dtge6 g.3.9.1 (E:157-311) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} dicpgtakgktncpatvingqfvercwthshcqkvcptickshgctaeglcchseclgnc sqpddptkcvacrnfyldgrcvetcpppyyhfqdwrcvnfsfcqdlhhkcknsrrqgchq yvihnnkcipecpsgytmnssnllctpclgpcpkv
Timeline for d2dtge6: