SCOP 1.75: Domain d2dtge6: 2dtg E:157-311

Lineage for d2dtge6 (2dtg E:157-311)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.9: Growth factor receptor domain [57184] (1 family)

5. Family g.3.9.1: Growth factor receptor domain [57185] (8 proteins)

6. Protein Insulin receptor [161122] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [161123] (1 PDB entry)
   Uniprot P06213 184-338

8. Domain d2dtge6: 2dtg E:157-311 [145105]
   Other proteins in same PDB: d2dtga1, d2dtgb1, d2dtgb2, d2dtgc1, d2dtgc2, d2dtgd1, d2dtge1, d2dtge2, d2dtge3, d2dtge4, d2dtge5
   mutant

Details for d2dtge6

PDB Entry: 2dtg, 3.8 Å

PDB Description: insulin receptor (ir) ectodomain in complex with fab's

PDB Compounds: (E:) Insulin receptor

SCOP Domain Sequences for d2dtge6:

Sequence; same for both SEQRES and ATOM records:

>d2dtge6 g.3.9.1 (E:157-311) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}
dicpgtakgktncpatvingqfvercwthshcqkvcptickshgctaeglcchseclgnc
sqpddptkcvacrnfyldgrcvetcpppyyhfqdwrcvnfsfcqdlhhkcknsrrqgchq
yvihnnkcipecpsgytmnssnllctpclgpcpkv

Timeline for d2dtge6:

• d2dtge6 is new in SCOP 1.75
  
• d2dtge6 appears in SCOPe 2.01
  
• d2dtge6 appears in the current release, SCOPe 2.08