Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.5: L domain [52071] (6 proteins) this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain |
Protein Insulin receptor [159452] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [159453] (1 PDB entry) Uniprot P06213 31-183! Uniprot P06213 339-494 |
Domain d2dtge5: 2dtg E:312-467 [145104] Other proteins in same PDB: d2dtga1, d2dtgb1, d2dtgb2, d2dtgc1, d2dtgc2, d2dtgd1, d2dtge1, d2dtge2, d2dtge3, d2dtge6 |
PDB Entry: 2dtg (more details), 3.8 Å
SCOPe Domain Sequences for d2dtge5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dtge5 c.10.2.5 (E:312-467) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} chllegektidsvtsaqelrgctvingsliinirggnnlaaeleanlglieeisgylkir rsyalvslsffrklrlirgetleignysfyaldnqnlrqlwdwskhnltitqgklffhyn pklclseihkmeevsgtkgrqerndialktngdqas
Timeline for d2dtge5: