Lineage for d2dtge5 (2dtg E:312-467)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851636Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2851705Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2851793Family c.10.2.5: L domain [52071] (6 proteins)
    this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain
  6. 2851819Protein Insulin receptor [159452] (1 species)
  7. 2851820Species Human (Homo sapiens) [TaxId:9606] [159453] (1 PDB entry)
    Uniprot P06213 31-183! Uniprot P06213 339-494
  8. 2851822Domain d2dtge5: 2dtg E:312-467 [145104]
    Other proteins in same PDB: d2dtga1, d2dtgb1, d2dtgb2, d2dtgc1, d2dtgc2, d2dtgc3, d2dtgd1, d2dtge1, d2dtge2, d2dtge3, d2dtge6

Details for d2dtge5

PDB Entry: 2dtg (more details), 3.8 Å

PDB Description: insulin receptor (ir) ectodomain in complex with fab's
PDB Compounds: (E:) Insulin receptor

SCOPe Domain Sequences for d2dtge5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dtge5 c.10.2.5 (E:312-467) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}
chllegektidsvtsaqelrgctvingsliinirggnnlaaeleanlglieeisgylkir
rsyalvslsffrklrlirgetleignysfyaldnqnlrqlwdwskhnltitqgklffhyn
pklclseihkmeevsgtkgrqerndialktngdqas

SCOPe Domain Coordinates for d2dtge5:

Click to download the PDB-style file with coordinates for d2dtge5.
(The format of our PDB-style files is described here.)

Timeline for d2dtge5: