Lineage for d2dtge3 (2dtg E:468-592)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. Protein Insulin receptor [158901] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [158902] (1 PDB entry)
    Uniprot P06213 495-618
  8. Domain d2dtge3: 2dtg E:468-592 [145102]
    Other proteins in same PDB: d2dtga1, d2dtgb1, d2dtgb2, d2dtgc1, d2dtgc2, d2dtgc3, d2dtgd1, d2dtge4, d2dtge5, d2dtge6

Details for d2dtge3

PDB Entry: 2dtg (more details), 3.8 Å

PDB Description: insulin receptor (ir) ectodomain in complex with fab's
PDB Compounds: (E:) Insulin receptor

SCOPe Domain Sequences for d2dtge3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}
cenellkfsyirtsfdkillrwepywppdfrdllgfmlfykeapyqnvtefdgqdacgsn
swtvvdidpplrsndpksqnhpgwlmrglkpwtqyaifvktlvtfsderrtygaksdiiy
vqtda

SCOPe Domain Coordinates for d2dtge3 are not available.

Timeline for d2dtge3:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dtge1, d2dtge2, d2dtge4, d2dtge5, d2dtge6
View in 3D
Domains from other chains:
(mouse over for more information)
d2dtga1, d2dtgb1, d2dtgb2, d2dtgc1, d2dtgc2, d2dtgc3, d2dtgd1