Lineage for d2dtge1 (2dtg E:808-909)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2035676Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2035677Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2035955Protein Insulin receptor [158901] (1 species)
  7. 2035956Species Human (Homo sapiens) [TaxId:9606] [158902] (1 PDB entry)
    Uniprot P06213 495-618
  8. 2035957Domain d2dtge1: 2dtg E:808-909 [145100]
    Other proteins in same PDB: d2dtga1, d2dtgb1, d2dtgb2, d2dtgc1, d2dtgc2, d2dtgd1, d2dtge4, d2dtge5, d2dtge6

Details for d2dtge1

PDB Entry: 2dtg (more details), 3.8 Å

PDB Description: insulin receptor (ir) ectodomain in complex with fab's
PDB Compounds: (E:) Insulin receptor

SCOPe Domain Sequences for d2dtge1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}
eakaddivgpvtheifennvvhlmwqepkepnglivlyevsyrrygdeelhlcdtrkhfa
lergcrlrglspgnysvriratslagngswteptyfyvtdyl

SCOPe Domain Coordinates for d2dtge1:

Click to download the PDB-style file with coordinates for d2dtge1.
(The format of our PDB-style files is described here.)

Timeline for d2dtge1: