Lineage for d2dtgb1 (2dtg B:1-112)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1288590Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1288992Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (46 PDB entries)
  8. 1289053Domain d2dtgb1: 2dtg B:1-112 [145095]
    Other proteins in same PDB: d2dtga1, d2dtgb2, d2dtgc1, d2dtgc2, d2dtge1, d2dtge2, d2dtge3, d2dtge4, d2dtge5, d2dtge6

Details for d2dtgb1

PDB Entry: 2dtg (more details), 3.8 Å

PDB Description: insulin receptor (ir) ectodomain in complex with fab's
PDB Compounds: (B:) fab 83-7 light chain

SCOPe Domain Sequences for d2dtgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dtgb1 b.1.1.1 (B:1-112) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
divmsqspsslvvsvgekvtmsckssqsllyssnqknflawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltissvkaedlavyycqqyfryrtfgggtkleik

SCOPe Domain Coordinates for d2dtgb1:

Click to download the PDB-style file with coordinates for d2dtgb1.
(The format of our PDB-style files is described here.)

Timeline for d2dtgb1: