Lineage for d2dsrg1 (2dsr G:151-229)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1243670Fold g.28: Thyroglobulin type-1 domain [57609] (1 superfamily)
    disulfide-rich, alpha+beta
  4. 1243671Superfamily g.28.1: Thyroglobulin type-1 domain [57610] (1 family) (S)
  5. 1243672Family g.28.1.1: Thyroglobulin type-1 domain [57611] (5 proteins)
    Pfam PF00086
  6. 1243684Protein Insulin-like growth factor-binding protein 4, IGFBP4 [161144] (1 species)
  7. 1243685Species Human (Homo sapiens) [TaxId:9606] [161145] (1 PDB entry)
    Uniprot P22692 172-250
  8. 1243686Domain d2dsrg1: 2dsr G:151-229 [145094]
    Other proteins in same PDB: d2dsrb_, d2dsri_

Details for d2dsrg1

PDB Entry: 2dsr (more details), 2.1 Å

PDB Description: Structural Basis for the Inhibition of Insulin-like Growth Factors by IGF Binding Proteins
PDB Compounds: (G:) Insulin-like growth factor-binding protein 4

SCOPe Domain Sequences for d2dsrg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dsrg1 g.28.1.1 (G:151-229) Insulin-like growth factor-binding protein 4, IGFBP4 {Human (Homo sapiens) [TaxId: 9606]}
gscqselhralerlaasqsrthedlyiipipncdrngnfhpkqchpaldgqrgkcwcvdr
ktgvklpgglepkgeldch

SCOPe Domain Coordinates for d2dsrg1:

Click to download the PDB-style file with coordinates for d2dsrg1.
(The format of our PDB-style files is described here.)

Timeline for d2dsrg1: