![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) ![]() |
![]() | Family g.3.9.1: Growth factor receptor domain [57185] (10 proteins) Pfam PF00757; Pfam PF14843; Pfam PF15913 |
![]() | Protein automated matches [190609] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187631] (7 PDB entries) |
![]() | Domain d2dsrb_: 2dsr B: [145093] Other proteins in same PDB: d2dsrg1, d2dsri_ automated match to d2dspb1 |
PDB Entry: 2dsr (more details), 2.1 Å
SCOPe Domain Sequences for d2dsrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dsrb_ g.3.9.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} aihcppcseeklarcrppvgceelvrepgcgccatcalglgmpcgvytprcgsglrcypp rgvekplhtlmhgqgvcmel
Timeline for d2dsrb_: