Lineage for d2dsqh_ (2dsq H:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2639636Fold g.28: Thyroglobulin type-1 domain [57609] (1 superfamily)
    disulfide-rich, alpha+beta
  4. 2639637Superfamily g.28.1: Thyroglobulin type-1 domain [57610] (2 families) (S)
  5. 2639638Family g.28.1.1: Thyroglobulin type-1 domain [57611] (5 proteins)
    Pfam PF00086
  6. 2639653Protein automated matches [190610] (1 species)
    not a true protein
  7. 2639654Species Human (Homo sapiens) [TaxId:9606] [187632] (3 PDB entries)
  8. 2639657Domain d2dsqh_: 2dsq H: [145092]
    Other proteins in same PDB: d2dsqa_, d2dsqb_, d2dsqc_, d2dsqg1, d2dsqi_
    automated match to d2dsqg1

Details for d2dsqh_

PDB Entry: 2dsq (more details), 2.8 Å

PDB Description: Structural Basis for the Inhibition of Insulin-like Growth Factors by IGF Binding Proteins
PDB Compounds: (H:) Insulin-like growth factor-binding protein 1

SCOPe Domain Sequences for d2dsqh_:

Sequence, based on SEQRES records: (download)

>d2dsqh_ g.28.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kepcrielyrvveslakaqetsgeeiskfylpncnkngfyhsrqcetsmdgeaglcwcvy
pwngkripgspeirgdpnc

Sequence, based on observed residues (ATOM records): (download)

>d2dsqh_ g.28.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kepcrielyrvveslfylpncnkngfyhsrqcglcwcvypwngkripgspeirgdpnc

SCOPe Domain Coordinates for d2dsqh_:

Click to download the PDB-style file with coordinates for d2dsqh_.
(The format of our PDB-style files is described here.)

Timeline for d2dsqh_: