Lineage for d2dsqh1 (2dsq H:149-226)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 891925Fold g.28: Thyroglobulin type-1 domain [57609] (1 superfamily)
    disulfide-rich, alpha+beta
  4. 891926Superfamily g.28.1: Thyroglobulin type-1 domain [57610] (1 family) (S)
  5. 891927Family g.28.1.1: Thyroglobulin type-1 domain [57611] (4 proteins)
    Pfam PF00086
  6. 891936Protein Insulin-like growth factor-binding protein 1, IGFBP1 [161142] (1 species)
  7. 891937Species Human (Homo sapiens) [TaxId:9606] [161143] (1 PDB entry)
    Uniprot P08833 174-256
  8. 891939Domain d2dsqh1: 2dsq H:149-226 [145092]
    Other proteins in same PDB: d2dsqa1, d2dsqb1, d2dsqc1, d2dsqi1
    automatically matched to 2DSQ G:149-231

Details for d2dsqh1

PDB Entry: 2dsq (more details), 2.8 Å

PDB Description: Structural Basis for the Inhibition of Insulin-like Growth Factors by IGF Binding Proteins
PDB Compounds: (H:) Insulin-like growth factor-binding protein 1

SCOP Domain Sequences for d2dsqh1:

Sequence, based on SEQRES records: (download)

>d2dsqh1 g.28.1.1 (H:149-226) Insulin-like growth factor-binding protein 1, IGFBP1 {Human (Homo sapiens) [TaxId: 9606]}
epcrielyrvveslakaqetsgeeiskfylpncnkngfyhsrqcetsmdgeaglcwcvyp
wngkripgspeirgdpnc

Sequence, based on observed residues (ATOM records): (download)

>d2dsqh1 g.28.1.1 (H:149-226) Insulin-like growth factor-binding protein 1, IGFBP1 {Human (Homo sapiens) [TaxId: 9606]}
epcrielyrvveslfylpncnkngfyhsrqcglcwcvypwngkripgspeirgdpnc

SCOP Domain Coordinates for d2dsqh1:

Click to download the PDB-style file with coordinates for d2dsqh1.
(The format of our PDB-style files is described here.)

Timeline for d2dsqh1: