SCOPe 2.08: Domain d2dsqh_: 2dsq H:

Lineage for d2dsqh_ (2dsq H:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.28: Thyroglobulin type-1 domain [57609] (1 superfamily)
   disulfide-rich, alpha+beta

4. Superfamily g.28.1: Thyroglobulin type-1 domain [57610] (2 families)

5. Family g.28.1.1: Thyroglobulin type-1 domain [57611] (5 proteins)
   Pfam PF00086

6. Protein automated matches [190610] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187632] (3 PDB entries)

8. Domain d2dsqh_: 2dsq H: [145092]
   Other proteins in same PDB: d2dsqa_, d2dsqb_, d2dsqc_, d2dsqg1, d2dsqi_
   automated match to d2dsqg1

Details for d2dsqh_

PDB Entry: 2dsq, 2.8 Å

PDB Description: Structural Basis for the Inhibition of Insulin-like Growth Factors by IGF Binding Proteins

PDB Compounds: (H:) Insulin-like growth factor-binding protein 1

SCOPe Domain Sequences for d2dsqh_:

Sequence, based on SEQRES records:

>d2dsqh_ g.28.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kepcrielyrvveslakaqetsgeeiskfylpncnkngfyhsrqcetsmdgeaglcwcvy
pwngkripgspeirgdpnc

Sequence, based on observed residues (ATOM records):

>d2dsqh_ g.28.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kepcrielyrvveslfylpncnkngfyhsrqcglcwcvypwngkripgspeirgdpnc

Timeline for d2dsqh_:

• d2dsqh_ first appeared in SCOP 1.75, called d2dsqh1
  
• d2dsqh_ appears in SCOPe 2.07