SCOP 1.75: Domain d2dsqg1: 2dsq G:149-231

Lineage for d2dsqg1 (2dsq G:149-231)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.28: Thyroglobulin type-1 domain [57609] (1 superfamily)
   disulfide-rich, alpha+beta

4. Superfamily g.28.1: Thyroglobulin type-1 domain [57610] (1 family)

5. Family g.28.1.1: Thyroglobulin type-1 domain [57611] (4 proteins)
   Pfam PF00086

6. Protein Insulin-like growth factor-binding protein 1, IGFBP1 [161142] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [161143] (1 PDB entry)
   Uniprot P08833 174-256

8. Domain d2dsqg1: 2dsq G:149-231 [145091]
   Other proteins in same PDB: d2dsqa1, d2dsqb1, d2dsqc1, d2dsqi1

Details for d2dsqg1

PDB Entry: 2dsq, 2.8 Å

PDB Description: Structural Basis for the Inhibition of Insulin-like Growth Factors by IGF Binding Proteins

PDB Compounds: (G:) Insulin-like growth factor-binding protein 1

SCOP Domain Sequences for d2dsqg1:

Sequence, based on SEQRES records:

>d2dsqg1 g.28.1.1 (G:149-231) Insulin-like growth factor-binding protein 1, IGFBP1 {Human (Homo sapiens) [TaxId: 9606]}
epcrielyrvveslakaqetsgeeiskfylpncnkngfyhsrqcetsmdgeaglcwcvyp
wngkripgspeirgdpncqiyfn

Sequence, based on observed residues (ATOM records):

>d2dsqg1 g.28.1.1 (G:149-231) Insulin-like growth factor-binding protein 1, IGFBP1 {Human (Homo sapiens) [TaxId: 9606]}
epcrielyrvveslakaskfylpncnkngfyhsrqcetsmeaglcwcvypwngkripgsp
eirgdpncqiyfn

Timeline for d2dsqg1:

• d2dsqg1 is new in SCOP 1.75
  
• d2dsqg1 appears in SCOPe 2.01
  
• d2dsqg1 appears in the current release, SCOPe 2.08