![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.9: Growth factor receptor domain [57184] (1 family) ![]() |
![]() | Family g.3.9.1: Growth factor receptor domain [57185] (9 proteins) |
![]() | Protein automated matches [190609] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187631] (2 PDB entries) |
![]() | Domain d2dsqb_: 2dsq B: [145090] Other proteins in same PDB: d2dsqc_, d2dsqg1, d2dsqh_, d2dsqi_ automated match to d2dspb1 |
PDB Entry: 2dsq (more details), 2.8 Å
SCOPe Domain Sequences for d2dsqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dsqb_ g.3.9.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} aihcppcseeklarcrppvgceelvrepgcgccatcalglgmpcgvytprcgsglrcypp rgvekplhtlmhgqgvcmelaeieaiq
Timeline for d2dsqb_: